PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN41823.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 331aa    MW: 38388.8 Da    PI: 8.8604
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN41823.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK841.4e-26204253352
      RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 ++isl+dl kyF +pi +A+++L+v+lTvLKr+CR++GI+RWPhRkiksl
  KHN41823.1 204 AKISLSDLVKYFGMPIVEASRNLNVGLTVLKRKCREFGIPRWPHRKIKSL 253
                 589*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.429188273IPR003035RWP-RK domain
PfamPF020421.1E-21206253IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MDSSHTNTTL LTNLLVFNNT LQPELMRSVH VYRRGGGEKR EVEREFVFSE SGSYVEMQAT  60
PIPGLVKSRV SEVCEGHRNG VWLCVFAFHA DHTPQFCRIP RLLLVTRNPK LKMIPNLLDD  120
LHMIYKLNRK EEDRDIAQDS TGEERQGHSN NFQPSRKVFP VLDQDLNFLP YEDYESESPD  180
NETDVESSPG FLVKKKRAPS DLVAKISLSD LVKYFGMPIV EASRNLNVGL TVLKRKCREF  240
GIPRWPHRKI KSLDSLIHDL QEEAKNQELE DREAAMAVAK RQRMLESEKE NIEKKPFMDI  300
KIETKRFRQD VFKRRHRARA VEKHNSTVSS T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0903770.0BT090377.1 Soybean clone JCVI-FLGm-4G14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014618960.10.0PREDICTED: uncharacterized protein LOC100306328 isoform X1
SwissprotO817914e-92RKD5_ARATH; Protein RKD5
TrEMBLA0A0R0HMB10.0A0A0R0HMB1_SOYBN; Uncharacterized protein
TrEMBLA0A0B2SAS90.0A0A0B2SAS9_GLYSO; Protein RKD5
STRINGGLYMA01G36360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96463042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.14e-82RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]